SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22094125|ref|NP_065879.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22094125|ref|NP_065879.1|
Domain Number 1 Region: 97-158
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-27
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 737-794
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 681-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 456-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 418-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.18e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 783-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000815
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 10 Region: 230-283
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000115
Family KRAB domain (Kruppel-associated box) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22094125|ref|NP_065879.1|
Sequence length 868
Comment zinc finger protein 28 homolog [Homo sapiens]
Sequence
MRGAASASVREPTPLPGRGAPRTKPRAGRGPTVGTPATLALPARGRPRSRNGLASKGQRG
AAPTGPGHRALPSRDTALPQERNKKLEAVGTGIEPKAMSQGLVTFGDVAVDFSQEEWEWL
NPIQRNLYRKVMLENYRNLASLGLCVSKPDVISSLEQGKEPWTVKRKMTRAWCPDLKAVW
KIKELPLKKDFCEGKLSQAVITERLTSYNLEYSLLGEHWDYDALFETQPGLVTIKNLAVD
FRQQLHPAQKNFCKNGIWENNSDLGSAGHCVAKPDLVSLLEQEKEPWMVKRELTGSLFSG
QRSVHETQELFPKQDSYAEGVTDRTSNTKLDCSSFRENWDSDYVFGRKLAVGQETQFRQE
PITHNKTLSKERERTYNKSGRWFYLDDSEEKVHNRDSIKNFQKSSVVIKQTGIYAGKKLF
KCNECKKTFTQSSSLTVHQRIHTGEKPYKCNECGKAFSDGSSFARHQRCHTGKKPYECIE
CGKAFIQNTSLIRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYKCDVCHK
SFRYGSSLTVHQRIHTGEKPYECDVCRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQ
NIHLASHLRIHTGEKPFECAECGKSFSISSQLATHQRIHTGEKPYECKVCSKAFTQKAHL
AQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKCMECGKAFGDNSSCTQHQ
RLHTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPYECSVCGKAFSHRQSLSVHQRIHS
GKKPYECKECRKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS
TCPSLPSTSNPVDLFPKFLWNPSSLPSP
Download sequence
Identical sequences Q8NHY6
ENSP00000301318 9606.ENSP00000301318 gi|22094125|ref|NP_065879.1| NP_065879.1.87134 NP_065879.1.92137 ENSP00000301318 ENSP00000301318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]