SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221316645|ref|NP_001137544.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221316645|ref|NP_001137544.1|
Domain Number 1 Region: 291-344
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000486
Family UBA domain 0.013
Further Details:      
 
Domain Number 2 Region: 14-193
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000916
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221316645|ref|NP_001137544.1|
Sequence length 344
Comment ubiquitin-associated domain-containing protein 2 isoform 1 [Homo sapiens]
Sequence
MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICG
RIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGI
TAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIW
IVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLD
IQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAA
PPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences A0A024RE02 G2HEI7 Q8NBM4
ENSP00000383911 ENSP00000347928 ENSPTRP00000053400 9598.ENSPTRP00000053400 9606.ENSP00000383911 ENSPTRP00000053400 NP_001137544.1.87134 NP_001137544.1.92137 NP_001233420.1.37143 gi|221316645|ref|NP_001137544.1| ENSP00000383911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]