SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223468657|ref|NP_003018.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223468657|ref|NP_003018.3|
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-78
Family BAR domain 0.0000000566
Further Details:      
 
Domain Number 2 Region: 284-344
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223468657|ref|NP_003018.3|
Sequence length 347
Comment endophilin-A3 [Homo sapiens]
Sequence
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGES
MKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPD
EEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKL
QMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPEN
QGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences Q99963
NP_003018.3.87134 NP_003018.3.92137 9606.ENSP00000391372 HR4491 ENSP00000391372 gi|223468657|ref|NP_003018.3| ENSP00000391372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]