SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226246665|ref|NP_001139698.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226246665|ref|NP_001139698.1|
Domain Number 1 Region: 324-395
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.01e-21
Family Intermediate filament protein, coiled coil region 0.00077
Further Details:      
 
Domain Number 2 Region: 124-158
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000256
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 3 Region: 165-234
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000183
Family Intermediate filament protein, coiled coil region 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226246665|ref|NP_001139698.1|
Sequence length 469
Comment keratin, type II cytoskeletal 72 isoform 2 [Homo sapiens]
Sequence
MSRQLTHFPRGERLGFSGCSAVLSGGIGSSSASFRARVKGSASFGSKSLSCLGGSRSLAL
SAAARRGGGRLGGFVGTAFGSAGLGPKCPSVCPPGGIPQVTVNKSLLAPLNVEMDPEIQR
VRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYI
SNLQKQLEMLSGDGVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDVDAAY
MNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSIVLSMDNNRDLDLDSIIAEVR
AQYEEIALKSKAEAETLYQTKCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEE
LARMLREYQELVSLKLALDMEIATYRKLLESEECRMSGEYPNSVSISVISSTNAGAGGAG
FSMGFGASSSYSYKTAAADVKTKGSCGSELKDPLAKTSGSSCATKKASR
Download sequence
Identical sequences ENSP00000346269 gi|226246665|ref|NP_001139698.1| ENSP00000346269 NP_001139698.1.87134 NP_001139698.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]