SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226437621|ref|NP_001139816.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226437621|ref|NP_001139816.1|
Domain Number 1 Region: 141-370
Classification Level Classification E-value
Superfamily RNI-like 1.96e-20
Family 28-residue LRR 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226437621|ref|NP_001139816.1|
Sequence length 436
Comment PRAME family member 11 [Homo sapiens]
Sequence
MEAFSRRRCEALKLMVQAWPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVRPRRWKL
QVLDLQDVCENFWMVWSEAMAHGCFLNAKRNKTPVQDCPRMRERQPLTVFVELWLKNRTL
DEYLTCLLLWVKQRRDLLHLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWILPI
LTQFTPYLGHLRNLQKLVLSHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQKLYMNSVSF
LEGHLDQLLSCLKTSLKVLTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVP
LQILLEKVAATLEYLDLDDCGIIDSQVNAILPALSRCFELNTFSFCGNPICMATLENLLS
HTIILKNLCLELYPAPQESYGADGTLCWSRFAQIRAELMKKVRHLRHPKRILFCTDNCPD
HGDRSFYDLEADQYCC
Download sequence
Identical sequences gi|226437621|ref|NP_001139816.1| 9606.ENSP00000328783 ENSP00000439551 ENSP00000439551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]