SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|23308733|ref|NP_056470.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23308733|ref|NP_056470.1|
Domain Number 1 Region: 245-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 7-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-22
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 4 Region: 525-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 441-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-20
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 329-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 581-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-20
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 8 Region: 637-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 679-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.51e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 206-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000119
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 291-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000271
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 487-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000014
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 13 Region: 179-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000678
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|23308733|ref|NP_056470.1|
Sequence length 751
Comment zinc finger protein 337 [Homo sapiens]
Sequence
MGPQGARRQAFLAFGDVTVDFTQKEWRLLSPAQRALYREVTLENYSHLVSLGILHSKPEL
IRRLEQGEVPWGEERRRRPGPCAGIYAEHVLRPKNLGLAHQRQQQLQFSDQSFQSDTAEG
QEKEKSTKPMAFSSPPLRHAVSSRRRNSVVEIESSQGQRENPTEIDKVLKGIENSRWGAF
KCAERGQDFSRKMMVIIHKKAHSRQKLFTCRECHQGFRDESALLLHQNTHTGEKSYVCSV
CGRGFSLKANLLRHQRTHSGEKPFLCKVCGRGYTSKSYLTVHERTHTGEKPYECQECGRR
FNDKSSYNKHLKAHSGEKPFVCKECGRGYTNKSYFVVHKRIHSGEKPYRCQECGRGFSNK
SHLITHQRTHSGEKPFACRQCKQSFSVKGSLLRHQRTHSGEKPFVCKDCERSFSQKSTLV
YHQRTHSGEKPFVCRECGQGFIQKSTLVKHQITHSEEKPFVCKDCGRGFIQKSTFTLHQR
THSEEKPYGCRECGRRFRDKSSYNKHLRAHLGEKRFFCRDCGRGFTLKPNLTIHQRTHSG
EKPFMCKQCEKSFSLKANLLRHQWTHSGERPFNCKDCGRGFILKSTLLFHQKTHSGEKPF
ICSECGQGFIWKSNLVKHQLAHSGKQPFVCKECGRGFNWKGNLLTHQRTHSGEKPFVCNV
CGQGFSWKRSLTRHHWRIHSKEKPFVCQECKRGYTSKSDLTVHERIHTGERPYECQECGR
KFSNKSYYSKHLKRHLREKRFCTGSVGEASS
Download sequence
Identical sequences Q9Y3M9
ENSP00000252979 9606.ENSP00000252979 NP_001277190.1.87134 NP_001277190.1.92137 NP_056470.1.87134 NP_056470.1.92137 XP_006723621.1.92137 XP_011527521.1.92137 ENSP00000252979 ENSP00000365619 ENSP00000252979 ENSP00000365619 gi|23308733|ref|NP_056470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]