SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239582722|ref|NP_001103279.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239582722|ref|NP_001103279.2|
Domain Number 1 Region: 41-101
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-21
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 2 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 174-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000017
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 4 Region: 383-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000434
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 420-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000495
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239582722|ref|NP_001103279.2|
Sequence length 536
Comment zinc finger protein 57 homolog [Homo sapiens]
Sequence
MFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARVKKKPVTFEDVAVNFTQEEWDC
LDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGK
KKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPFFCYTC
GKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTY
CDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGT
QAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAP
ITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKS
FSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILG
QWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK
Download sequence
Identical sequences A0A1U9X8V5
ENSP00000418259 ENSP00000446798 ENSP00000447495 ENSP00000448351 ENSP00000449230 ENSP00000449407 ENSP00000450279 NP_001103279.2.87134 NP_001103279.2.92137 XP_011512872.1.92137 ENSP00000418259 ENSP00000446798 ENSP00000447495 ENSP00000448351 ENSP00000449230 ENSP00000449407 ENSP00000450279 ENSP00000366080 ENSP00000446541 ENSP00000446798 ENSP00000447495 ENSP00000447698 ENSP00000448351 ENSP00000450279 gi|239582722|ref|NP_001103279.2| 9606.ENSP00000411069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]