SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|239747114|ref|XP_002343914.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239747114|ref|XP_002343914.1|
Domain Number 1 Region: 126-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.27e-60
Family Ankyrin repeat 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239747114|ref|XP_002343914.1|
Sequence length 584
Comment PREDICTED: POTE ankyrin domain family member D-like isoform 1 [Homo sapiens]
Sequence
MVAEVCSMPTASTVKKPFDLRSKMGKWCHHRFPCCRGSGKSNMGTSGDHDDSFMKMLRSK
MGKCCRHCFPCCRGSGTSNVGTSGDHENSFMKMLRSKMGKWCCHCFPCCRGSSKSNVGAW
GDYDHSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKEKRTALHLA
SANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAIQCQEDECVLMLLEHGADRNIPDEYGN
TALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQQVVKFLIKKKANLNV
LDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVICELLSDY
KEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIK
KHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRKPENQQFPDTENEEYHSDEQNDTRKQL
SEEQNTGISQDEILTNKQKQIEVAEQKMNSELSLSHKKEEDLLRENSVLQEEIAVLRLEL
DETKHQNQLRENKILEEIESVKEKTDKLLRAMQLNEEALTKTNI
Download sequence
Identical sequences ENSP00000479139 ENSP00000329990 9606.ENSP00000329990 NP_001244291.1.92137 gi|239747114|ref|XP_002343914.1| ENSP00000329990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]