SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|24308171|ref|NP_060136.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24308171|ref|NP_060136.1|
Domain Number 1 Region: 384-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000386
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  gi|24308171|ref|NP_060136.1|
Domain Number - Region: 349-371,415-475
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0176
Family Cytochrome c3-like 0.051
Further Details:      
 
Domain Number - Region: 236-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0194
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24308171|ref|NP_060136.1|
Sequence length 737
Comment zinc finger protein 280C [Homo sapiens]
Sequence
MDDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDEDDDELIFVGEISSSKPAISN
ILNRGHSSSSSKGIKSEPHSPGIPEIFRTASQRCRDPPSNPVAASPRFHLVSKSSQSSVT
VENASKPDFTKNSQVGSDNSSILLFDSTQESLPPSQDIPAIFREGMKNTSYVLKHPSTSK
VNSVTPKKPKTSEDVPQINPSTSLPLIGSPPVTSSQVMLSKGTNTSSPYDAGADYLRACP
KCNVQFNLLDPLKYHMKHCCPDMITKFLGVIVKSERPCDEDKTDSETGKLIMLVNEFYYG
RHEGVTEKEPKTYTTFKCFSCSKVLKNNIRFMNHMKHHLELEKQNNESWENHTTCQHCYR
QYPTPFQLQCHIESTHTPHEFSTICKICELSFETEHILLQHMKDTHKPGEMPYVCQVCQF
RSSTFSDVEAHFRAAHENTKNLLCPFCLKVSKMATPYMNHYMKHQKKGVHRCPKCRLQFL
TSKEKAEHKAQHRTFIKPKELEGLPPGAKVTIRASLGPLQSKLPTAPFGCAPGTSFLQVT
PPTSQNTTARNPRKSNASRSKTSKLHATTSTASKVNTSKPRGRIAKSKAKPSYKQKRQRN
RKNKMSLALKNIRCRRGIHKCIECHSKIKDFASHFSIYIHCSFCKYNTNCNKAFVNHMMS
SHSNHPGKRFCIFKKHSGTLRGITLVCLKCDFLADSSGLDRMAKHLSQRKTHTCQVIIEN
VSKSTSTSEPTTGCSLK
Download sequence
Identical sequences Q8ND82
ENSP00000360017 9606.ENSP00000360017 NP_060136.1.87134 NP_060136.1.92137 ENSP00000360017 ENSP00000360017 gi|24308171|ref|NP_060136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]