SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|24497572|ref|NP_695017.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|24497572|ref|NP_695017.1|
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8e-25
Family Bee venom hyaluronidase 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|24497572|ref|NP_695017.1|
Domain Number - Region: 154-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0204
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|24497572|ref|NP_695017.1|
Sequence length 176
Comment hyaluronidase-1 isoform 5 [Homo sapiens]
Sequence
MYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVV
LWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKAL
LLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
Download sequence
Identical sequences ENSP00000390149 ENSP00000461900 ENSP00000390149 NP_695017.1.87134 NP_695017.1.92137 gi|24497572|ref|NP_695017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]