SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256418948|ref|NP_009084.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256418948|ref|NP_009084.2|
Domain Number 1 Region: 1093-1150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 701-758
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 1009-1066
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 589-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 869-926
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 785-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 8 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 9 Region: 645-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 10 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 11 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 12 Region: 1178-1234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 14 Region: 433-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 15 Region: 954-1010
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 16 Region: 491-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 17 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 18 Region: 1223-1275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 19 Region: 832-864
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000236
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 20 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000371
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 21 Region: 1140-1172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000455
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 22 Region: 1056-1088
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000483
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 23 Region: 748-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000508
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 24 Region: 916-948
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000367
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256418948|ref|NP_009084.2|
Sequence length 1280
Comment zinc finger protein 208 [Homo sapiens]
Sequence
MGSLTFRDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAFKPDLIIFLEEGK
ESWNMKRHEMVEESPVICSHFAQDLWPEQGIEDSFQKVILRRYEKCGHENLHLKIGYTNV
DECKVHKEGYNKLNQSLTTTQSKVFQRGKYANVFHKCSNSNRHKIRHTGKKHLQCKEYVR
SFCMLSHLSQHKRIYTRENSYKCEEGGKAFNWSSTLTYYKSAHTGEKPYRCKECGKAFSK
FSILTKHKVIHTGEKSYKCEECGKAFNQSAILTKHKIIHTGEKPNKCEECGKAFSKVSTL
TTHKAIHAGEKPYKCKECGKAFSKVSTLITHKAIHAGEKPYKCKECGKAFSKFSILTKHK
VIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSMFSILTKHEVIHT
GEKPYKCEECGKAFNWSSNLMEHKKIHTGETPYKCEECGKGFSMFSILTKHKVIHNGEKP
YKCEECDKATHAGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSIL
TKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKAFNQSAILIKHK
RIHTGEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKTFIKVSTLTTHKAIHA
GEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKP
YKCEECGKSFSTFSVLTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCE
ECGKAFNRSAILIKHKRIHTDEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGK
AFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSM
FSILTKHEVIHTGEKPYKCEECGKAFSWLSVFSKHKKTHAGEKFYKCEACGKAYKSSSTL
SYHKKIHTEEKPYKYEECGKGFSTFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHK
KIHTGETPYKCEECDKAFSWPSSLTEHKATHAGEKPYKCEECGKAFSWPSRLTEHKATHA
GEEPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSILTKHKVIHTGEKP
YKCEECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKGFVMFSILAKHKVIHTGEKLYKCE
ECGKAYKWPSTLRYHKKIHTGEKPYKCEECGKAFSTFSILTKHKVIHTGEKPYKCEECGK
AFSWLSVFSKHKKIHTGEKL
Download sequence
Identical sequences O43345
ENSP00000380315 ENSP00000380315 gi|256418948|ref|NP_009084.2| ENSP00000380315 NP_009084.2.87134 NP_009084.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]