SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|259490323|ref|NP_001159354.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|259490323|ref|NP_001159354.1|
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 649-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 593-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 705-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 761-818
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 398-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 10 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 11 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 12 Region: 803-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 13 Region: 500-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000509
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 14 Region: 360-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000184
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  gi|259490323|ref|NP_001159354.1|
Domain Number - Region: 153-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0436
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|259490323|ref|NP_001159354.1|
Sequence length 864
Comment zinc finger protein 268 isoform c [Homo sapiens]
Sequence
MDVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSLGYQHTKPDIIFKLEQGEELCMVQ
AQVPNQTCPNTVWKIDDLMDWHQENKDKLGSTAKSFECTTFGKLCLLSTKYLSRQKPHKC
GTHGKSLKYIDFTSDYARNNPNGFQVHGKSFFHSKHEQTVIGIKYCESIESGKTVNKKSQ
LMCQQMYMGEKPFGCSCCEKAFSSKSYLLVHQQTHAEEKPYGCNECGKDFSSKSYLIVHQ
RIHTGEKLHECSECRKTFSFHSQLVIHQRIHTGENPYECCECGKVFSRKDQLVSHQKTHS
GQKPYVCNECGKAFGLKSQLIIHERIHTGEKPYECNECQKAFNTKSNLMVHQRTHTGEKP
YVCSDCGKAFTFKSQLIVHQGIHTGVKPYGCIQCGKGFSLKSQLIVHQRSHTGMKPYVCN
ECGKAFRSKSYLIIHTRTHTGEKLHECNNCGKAFSFKSQLIIHQRIHTGENPYECHECGK
AFSRKYQLISHQRTHAGEKPYECTDCGKAFGLKSQLIIHQRTHTGEKPFECSECQKAFNT
KSNLIVHQRTHTGEKPYSCNECGKAFTFKSQLIVHKGVHTGVKPYGCSQCAKTFSLKSQL
IVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTGEKPHECRECGKSFSFNSQLIVHQ
RIHTGENPYECSECGKAFNRKDQLISHQRTHAGEKPYGCSECGKAFSSKSYLIIHMRTHS
GEKPYECNECGKAFIWKSLLIVHERTHAGVNPYKCSQCEKSFSGKLRLLVHQRMHTREKP
YECSECGKAFIRNSQLIVHQRTHSGEKPYGCNECGKTFSQKSILSAHQRTHTGEKPCKCT
ECGKAFCWKSQLIMHQRTHVDDKH
Download sequence
Identical sequences NP_001159354.1.87134 NP_001159354.1.92137 gi|259490323|ref|NP_001159354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]