SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27502388|ref|NP_765976.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27502388|ref|NP_765976.1|
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.08e-49
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000581
Further Details:      
 
Domain Number 2 Region: 122-243
Classification Level Classification E-value
Superfamily E set domains 5.6e-32
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27502388|ref|NP_765976.1|
Sequence length 353
Comment nuclear factor of activated T-cells, cytoplasmic 1 isoform D [Homo sapiens]
Sequence
MLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVID
CAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSA
QELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCK
PNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPA
PTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLS
PAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQ
Download sequence
Identical sequences gi|27502388|ref|NP_765976.1| ENSP00000380892 ENSP00000380892 NP_765976.1.87134 NP_765976.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]