SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28274682|ref|NP_008905.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28274682|ref|NP_008905.1|
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-27
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 616-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-24
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 561-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 7 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 672-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 714-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 298-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000277
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Weak hits

Sequence:  gi|28274682|ref|NP_008905.1|
Domain Number - Region: 139-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00142
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number - Region: 242-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0125
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28274682|ref|NP_008905.1|
Sequence length 810
Comment zinc finger protein 33A isoform b [Homo sapiens]
Sequence
MNKVEQKSQESVSFKDVTVGFTQEEWQHLDPSQRALYRDVMLENYSNLVSVGYCVHKPEV
IFRLQQGEEPWKQEEEFPSQSFPVWTADHLKERSQENQSKHLWEVVFINNEMLTKEQGDV
IGIPFNVDVSSFPSRKMFCQCDSCGMSFNTVSELVISKINYLGKKSDEFNACGKLLLNIK
HDETHTQEKNEVLKNRNTLSHHEETLQHEKIQTLEHNFEYSICQETLLEKAVFNTQKREN
AEENNCDYNEFGRTLCDSSSLLFHQISPSRDNHYEFSDCEKFLCVKSTLSKPHGVSMKHY
DCGESGNNFRRKLCLSHLQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNE
CEKAFWDKSNLTKHQRSHTGEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCNACGKT
FCQKSDLTKHQRTHTGLKPYECYECGKSFRVTSHLKVHQRTHTGEKPFECLECGKSFSEK
SNLTQHQRIHIGDKSYECNACGKTFYHKSLLTRHQIIHTGWKPYECYECGKTFCLKSDLT
VHQRTHTGQKPFACPECGKFFSHKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNR
THTGEKPYECNECGKAFYQKSQLTQHQRIHIGEKPYKCNECGKAFCHKSALIVHQRTHTQ
EKPYKCNECGKSFCVKSGLIFHERKHTGEKPYECNECGKFFRHKSSLTVHHRAHTGEKSC
QCNECGKIFYRKSELAQHQRSHTGEKPYECNTCRKTFSQKSNLIVHQRRHIGENLMNEMD
IRNFQPQVSLHNASEYSHCGESPDDILNVQ
Download sequence
Identical sequences Q06730
ENSP00000387713 gi|28274682|ref|NP_008905.1| ENSP00000304268 ENSP00000387713 NP_008905.1.87134 NP_008905.1.92137 XP_011517953.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]