SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289546581|ref|NP_001166039.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289546581|ref|NP_001166039.1|
Domain Number 1 Region: 128-262
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.19e-28
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 20-122
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-23
Family DEATH domain, DD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289546581|ref|NP_001166039.1|
Sequence length 264
Comment myeloid differentiation primary response protein MyD88 isoform 3 [Homo sapiens]
Sequence
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELI
EKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFIT
VCDYTNPCTKSWFWTRLAKALSLP
Download sequence
Identical sequences A0A0A0MSI9
ENSP00000389979 ENSP00000389979 NP_001166039.1.87134 NP_001166039.1.92137 gi|289546581|ref|NP_001166039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]