SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289547701|ref|NP_115973.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289547701|ref|NP_115973.2|
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 661-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-25
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 717-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-24
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 8 Region: 605-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 773-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-17
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 260-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-16
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 11 Region: 344-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000138
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 12 Region: 568-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000206
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 13 Region: 428-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000488
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289547701|ref|NP_115973.2|
Sequence length 839
Comment zinc finger protein 347 isoform b [Homo sapiens]
Sequence
MALTQGQVTFRDVAIEFSQEEWTCLDPAQRTLYRDVMLENYRNLASLGISCFDLSIISML
EQGKEPFTLESQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVMLER
QESQDIEGCSFREVQKNTHGLEYQCRDAEGNYKGVLLTQEGNLTHGRDEHDKRDARNKLI
KNQLGLSLQSHLPELQLFQYEGKIYECNQVEKSFNNNSSVSPPQQMPYNVKTHISKKYLK
DFISSLLLTQGQKANNWGSPYKSNGCGMVFPQNSHLASHQRSHTKEKPYKCYECGKAFRT
RSNLTTHQVIHTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPYKCNECGKVFTQNSHL
VRHRGIHTGEKPYKCNECGKAFRARSSLAIHQATHSGEKPYKCNECGKVFTQNSHLTNHW
RIHTGEKPYKCNECGKAFGVRSSLAIHLVIHTGEKPYKCHECGKVFRRNSHLARHQLIHT
GEKPYKCNECGKAFRAHSNLTTHQVIHTGEKPYKCNECGKVFTQNSHLANHQRIHTGVKP
YMCNECGKAFSVYSSLTTHQVIHTGEKPYKCNECGKVFTQNSHLARHRGIHTGEKPYKCN
ECGKVFRHNSYLSRHQRIHTGEKPYKYNEYGKAFSEHSNLTTHQVIHTGEKPYKCNECGK
VFTQNSHLARHRRVHTGGKPYQCNECGKAFSQTSKLARHQRVHTGEKPYECNQCGKAFSV
RSSLTTHQAIHTGKKPYKCNECGKVFTQNSHLARHRGIHTGEKPYKCNECGKAFSQTSKL
ARHQRIHTGEKPYECGKPFSICSSLTTHQTIHTGGKPYKCNVWKVLKSEFKPCKPSQNS
Download sequence
Identical sequences Q96SE7
gi|289547701|ref|NP_115973.2| ENSP00000334146 9606.ENSP00000334146 ENSP00000334146 NP_115973.2.87134 NP_115973.2.92137 XP_005259392.1.92137 XP_016882873.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]