SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289547705|ref|NP_001166146.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289547705|ref|NP_001166146.1|
Domain Number 1 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 662-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-25
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 718-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-24
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 606-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 1-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 9 Region: 774-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-17
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 261-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-16
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 11 Region: 345-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000138
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 12 Region: 569-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000206
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 13 Region: 429-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000488
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289547705|ref|NP_001166146.1|
Sequence length 840
Comment zinc finger protein 347 isoform a [Homo sapiens]
Sequence
MALTQGQVTFRDVAIEFSQEEWTCLDPAQRTLYRDVMLENYRNLASLAGISCFDLSIISM
LEQGKEPFTLESQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVMLE
RQESQDIEGCSFREVQKNTHGLEYQCRDAEGNYKGVLLTQEGNLTHGRDEHDKRDARNKL
IKNQLGLSLQSHLPELQLFQYEGKIYECNQVEKSFNNNSSVSPPQQMPYNVKTHISKKYL
KDFISSLLLTQGQKANNWGSPYKSNGCGMVFPQNSHLASHQRSHTKEKPYKCYECGKAFR
TRSNLTTHQVIHTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPYKCNECGKVFTQNSH
LVRHRGIHTGEKPYKCNECGKAFRARSSLAIHQATHSGEKPYKCNECGKVFTQNSHLTNH
WRIHTGEKPYKCNECGKAFGVRSSLAIHLVIHTGEKPYKCHECGKVFRRNSHLARHQLIH
TGEKPYKCNECGKAFRAHSNLTTHQVIHTGEKPYKCNECGKVFTQNSHLANHQRIHTGVK
PYMCNECGKAFSVYSSLTTHQVIHTGEKPYKCNECGKVFTQNSHLARHRGIHTGEKPYKC
NECGKVFRHNSYLSRHQRIHTGEKPYKYNEYGKAFSEHSNLTTHQVIHTGEKPYKCNECG
KVFTQNSHLARHRRVHTGGKPYQCNECGKAFSQTSKLARHQRVHTGEKPYECNQCGKAFS
VRSSLTTHQAIHTGKKPYKCNECGKVFTQNSHLARHRGIHTGEKPYKCNECGKAFSQTSK
LARHQRIHTGEKPYECGKPFSICSSLTTHQTIHTGGKPYKCNVWKVLKSEFKPCKPSQNS
Download sequence
Identical sequences A0A024R4L7
NP_001166145.1.87134 NP_001166145.1.92137 NP_001166146.1.87134 NP_001166146.1.92137 ENSP00000405218 ENSP00000405218 ENSP00000471712 ENSP00000405218 ENSP00000471712 gi|289547703|ref|NP_001166145.1| gi|289547705|ref|NP_001166146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]