SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289547712|ref|NP_001166148.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289547712|ref|NP_001166148.1|
Domain Number 1 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.28e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 362-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 643-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000129
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 12 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000277
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 13 Region: 447-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000326
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289547712|ref|NP_001166148.1|
Sequence length 695
Comment zinc finger protein 607 isoform 2 [Homo sapiens]
Sequence
MSYGSITFGDVAIDFSHQEWEYLSLVQKTLYQEVMMENYDNLVSLGHSVSKPDLITLLEQ
GKEPWMIVREETRGECTDLDSRCEIISDGKMQLYRKHSCVTLHQRIHNGQKPYECKQCQK
SFSHLTELMVHQTIHTSEEPDQCEKFRKAFSHLTDLRKHQKINAREKPYECEECGKVFSY
PANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRLS
RHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFSHLVGHKR
IHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV
EKPYKCEECGKAFSVHGRLTRHQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKPY
KCKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQE
CGKGFSYSHKLTIHRRVHTGEKPYECKECGKAFSVSGQLTQHLSIHSGKKPFECNKCGKS
FRFISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSHA
SHLIIHERIHTSDKPYECKRCGKAFHCASYLVRHESVHADGNPYMCEECGKAFNSSHELS
IHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences ENSP00000438015 NP_001166148.1.87134 NP_001166148.1.92137 XP_006723499.1.92137 gi|289547712|ref|NP_001166148.1| ENSP00000438015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]