SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289547716|ref|NP_689492.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289547716|ref|NP_689492.3|
Domain Number 1 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 670-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 447-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 22-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 8 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 166-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 10 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 11 Region: 223-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 712-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 13 Region: 128-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000464
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289547716|ref|NP_689492.3|
Sequence length 769
Comment zinc finger protein 585B [Homo sapiens]
Sequence
MPASWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDLSQRNLYRDVMLETY
SHLLSVGYQVPKPEVVMLEQGKEPWALQGERPRHSCPGEKLWDHNQHRKIIGYKPASSQD
QKIYSGEKSYECAEFGKSFTWKSQFKVHLKVPTGEKLYVCIECGRAFVQKPEFITHQKTH
MREKPYKCNECGKSFFQVSSLFRHHRIHTGEKLYECSECGKGFPYNSDLSIHEKIHTGER
HHECTDCGKAFTQKSTLKIHQKIHTGERSYICIECGQAFIQKTQLIAHRRIHSGEKPYEC
NNCGKSFISKSQLQVHQRVHTRVKPYICTEYGKVFSNNSNLITHEKIQSREKSSICTECG
KAFTYRSELIIHQRIHTGEKPYECSDCGRAFTQKSALTVHQRIHTGEKSYICMKCGLAFI
RKAHLITHQIIHTGEKPYKCGHCGKLFTSKSQLHVHKRIHTGEKPYVCNKCGKAFTNRSN
LITHQKTHTGEKSYICSKCGKAFTQRSDLITHQRIHTGEKPYECNTCGKAFTQKSNLNIH
QKIHTGERQYECHECGKAFNQKSILIVHQKIHTGEKPYVCTECGRAFIRKSNFITHQRIH
TGEKPYECSDCGKSFTSKSQLLVHQPVHTGEKPYVCAECGKAFSGRSNLSKHQKTHTGEK
PYICSECGKTFRQKSELITHHRIHTGEKPYECSDCGKSFTKKSQLQVHQRIHTGEKPYVC
AECGKAFSNRSNLNKHQTTHTGDKPYKCGICGKGFVQKSVFSVHQSSHA
Download sequence
Identical sequences Q52M93
ENSP00000433773 9606.ENSP00000316933 gi|289547716|ref|NP_689492.3| NP_689492.3.87134 NP_689492.3.92137 ENSP00000433773 ENSP00000432760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]