SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296080693|ref|NP_001171651.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296080693|ref|NP_001171651.1|
Domain Number 1 Region: 43-565
Classification Level Classification E-value
Superfamily SIS domain 3.34e-214
Family Phosphoglucose isomerase, PGI 0.00000000000000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296080693|ref|NP_001171651.1|
Sequence length 569
Comment glucose-6-phosphate isomerase isoform 1 [Homo sapiens]
Sequence
MVALCSLQHLGSSDPRALPTLPTATSGQRPAKRRRKSPAMAALTRDPQFQKLQQWYREHR
SELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAAR
ERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQGPLMVTE
ALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWF
LQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVG
FDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFA
AYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIP
VQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFE
GNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPEL
DGSAQVTSHDASTNGLINFIKQQREARVQ
Download sequence
Identical sequences NP_001171651.1.87134 NP_001171651.1.92137 gi|296080693|ref|NP_001171651.1| ENSP00000405573 ENSP00000405573 ENSP00000348877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]