SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300116309|ref|NP_001177848.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300116309|ref|NP_001177848.1|
Domain Number 1 Region: 147-376
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-59
Family Nuclear receptor ligand-binding domain 0.000000000858
Further Details:      
 
Domain Number 2 Region: 52-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-27
Family Nuclear receptor 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300116309|ref|NP_001177848.1|
Sequence length 490
Comment thyroid hormone receptor alpha isoform 2 [Homo sapiens]
Sequence
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC
EDLAGNAASP
Download sequence
Identical sequences K7AAN9 P10827
ENSGGOP00000009438 gi|20127452|ref|NP_003241.2| gi|300116309|ref|NP_001177848.1| HR4734 9606.ENSP00000264637 ENSP00000264637 ENSP00000377679 ENSP00000264637 ENSP00000377679 NP_001177848.1.87134 NP_001177848.1.92137 NP_003241.2.87134 NP_003241.2.92137 ENSP00000264637 ENSGGOP00000009438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]