SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312032455|ref|NP_001185839.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312032455|ref|NP_001185839.1|
Domain Number 1 Region: 274-334
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312032455|ref|NP_001185839.1|
Sequence length 502
Comment C13orf38-SOHLH2 fusion protein [Homo sapiens]
Sequence
METLQESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGL
HQVSKRQQVDQLPRMQENLVKTLLLKEELDPLKAKIDILLVGDVTVGYLADTVQKLFANI
AEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFII
PENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSY
SEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQ
LRTLLPYVKGRKNDAASVLEATVDYVKYIREKISPAVMAQITEALQSNMRFCKKQQTPIE
LSLPGTVMAQRENSVMSTYSPERGLQFLTNTCWNGCSTPDAESSLDEAVRVPSSSASENA
IGDPYKTHISSAALSLNSLHTVRYYSKVTPSYDATAVTNQNISIHLPSAMPPVSKLLPRH
CTSGLGQTCTTHPNCLQQFWAY
Download sequence
Identical sequences ENSP00000421868 ENSP00000451542 gi|312032455|ref|NP_001185839.1| NP_001185839.1.87134 NP_001185839.1.92137 ENSP00000421868 ENSP00000421868 ENSP00000451542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]