SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|323510698|ref|NP_001191123.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323510698|ref|NP_001191123.1|
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily SRP19 1.19e-25
Family SRP19 0.00000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|323510698|ref|NP_001191123.1|
Sequence length 120
Comment signal recognition particle 19 kDa protein isoform 3 [Homo sapiens]
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKKNKMYSREWNRDVQYRGRVRV
QLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences A0A087WYR0 A0A2I3GY22 A0A2I3THT8 A0A2J8XEP7
NP_001191123.1.87134 NP_001191123.1.92137 XP_004087473.1.23891 ENSP00000482018 gi|323510698|ref|NP_001191123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]