SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32455266|ref|NP_859048.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32455266|ref|NP_859048.1|
Domain Number 1 Region: 7-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-74
Family Glutathione peroxidase-like 0.0000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32455266|ref|NP_859048.1|
Sequence length 199
Comment peroxiredoxin-1 [Homo sapiens]
Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK
Download sequence
Identical sequences H2PYX4 Q06830
ENSP00000262746 ENSP00000361152 9598.ENSPTRP00000001167 9606.ENSP00000262746 ENSP00000262746 ENSP00000361152 gi|320461711|ref|NP_001189360.1| gi|32455264|ref|NP_859047.1| gi|32455266|ref|NP_859048.1| gi|4505591|ref|NP_002565.1| Hs4505591___KOG0852 ENSP00000262746 NP_001189360.1.87134 NP_001189360.1.92137 NP_002565.1.87134 NP_002565.1.92137 NP_859047.1.87134 NP_859047.1.92137 NP_859048.1.87134 NP_859048.1.92137 XP_001156568.1.37143 XP_003308110.1.37143 XP_003812829.1.60992 XP_016817283.1.37143 ENSPTRP00000001167 ENSPTRP00000001167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]