SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|33354273|ref|NP_056178.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33354273|ref|NP_056178.3|
Domain Number 1 Region: 171-231
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 474-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 336-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000024
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 403-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000587
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  gi|33354273|ref|NP_056178.3|
Domain Number - Region: 311-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0953
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33354273|ref|NP_056178.3|
Sequence length 527
Comment zinc finger imprinted 2 [Homo sapiens]
Sequence
MYQPEDDNNSDVTSDDDMTRNRRESSPPHSVHSFSGDRDWDRRGRSRDMEPRDRWSHTRN
PRSRMPPRDLSLPVVAKTSFEMDREDDRDSRAYESRSQDAESYQNVVDLAEDRKPHNTIQ
DNMENYRKLLSLGFLAQDSVPAEKRNTEMLDNLPSAGSQFPDFKHLGTFLVFEELVTFED
VLVDFSPEELSSLSAAQRNLYREVMLENYRNLVSLGHQFSKPDIISRLEEEESYAMETDS
RHTVICQGESHDDPLEPHQGNQEKLLTPITMNDPKTLTPERSYGSDEFERSSNLSKQSKD
PLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRRHERIHTGKKPYECKQ
CAEAFYLMPHLNRHQKTHSGRKTSGCNEGRKPSVQCANLCERVRIHSQEDYFECFQCGKA
FLQNVHLLQHLKAHEAARVLPPGLSHSKTYLIRYQRKHDYVGERACQCCDCGRVFSRNSY
LIQHYRTHTQERPYQCQLCGKCFGRPSYLTQHYQLHSQEKTVECDHC
Download sequence
Identical sequences A0A024R4S8 Q9NZV7
ENSP00000221722 ENSP00000375589 ENSP00000468984 ENSP00000470326 ENSP00000472306 gi|226423927|ref|NP_001139798.1| gi|226423929|ref|NP_001139799.1| gi|33354273|ref|NP_056178.3| ENSP00000468984 ENSP00000470326 ENSP00000472306 NP_001139798.1.87134 NP_001139798.1.92137 NP_001139799.1.87134 NP_001139799.1.92137 NP_056178.3.87134 NP_056178.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]