SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336455120|ref|NP_001229609.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336455120|ref|NP_001229609.1|
Domain Number 1 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 608-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 664-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 832-889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 8 Region: 944-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 1112-1169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 776-833
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 11 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 12 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 13 Region: 1056-1113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 14 Region: 552-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 15 Region: 888-945
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 16 Region: 1001-1057
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 17 Region: 1158-1210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 18 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-18
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 19 Region: 706-758
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 20 Region: 174-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000216
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 21 Region: 1234-1252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000896
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336455120|ref|NP_001229609.1|
Sequence length 1252
Comment zinc finger protein 729 [Homo sapiens]
Sequence
MPGAPGSLEMGPLTFRDVTIEFSLEEWQCLDTVQQNLYRDVMLENYRNLVFLGMAVFKPD
LITCLKQGKEPWNMKRHEMVTKPPVMRSHFTQDLWPDQSTKDSFQEVILRTYARCGHKNL
RLRKDCKSANEGKMHKEGYNKLNQCRTATQRKIFQCNKHMKVFHKYSNRNKVRHTKKKTF
KCIKCSKSFFMLSCLIRHKRIHIRQNIYKCEERGKAFKSFSTLTKHKIIHTEDKPYKYKK
CGNAFKFSSTFTKHKRIHTGETPFRCEECGKAFNQSSNLTDHKRIHTGEKTYKCEECGKA
FKGSSNFNAHKVIHTAEKPYKCEDCGKTFNHFSALRKHKIIHTGKKPYKREECGKAFSQS
STLRKHEIIHTGEKPYKCEECGKAFKWSSKLTVHKVVHTGEKPYKCEECGKAFSQFSTLK
KHKIIHTGKKPYKCEECGKAFNSSSTLMKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKA
IHTGEKPYKCEECGKAFNHFSDLRRHKIIHTGKKPYKCEECGKAFSQSSTLRNHQIIHTG
EKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTREKLY
KCEECGKAFNNSSILAKHKIIHTGKKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEE
CGKAFSHFSALRRHKIIHTGKKPYKCEECGKAFSHFSALRRHKIIHTGEKPYKCEECGKA
FKWSSKLTVHKVIHTAEKPCKCEECGKSFKHFSALRKHKVIHTREKLYKCEECVKAFNSF
SALMKHKVIHTGEKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALR
KHKVIHTGKKPYKCEECGKAFSQSSSLRKHEIIHSGEKPYKCEECGKAFKWLSKLTVHKV
IHTAEKPCKCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNDSSTLMKHKIIHTG
KKPYKCAECGKAFKQSSHLTRHKAIHTGEKPYKCEECGKDFNNSSTLKKHKLIHTREKLY
KCEECVKAFNNFSALMKHKIIHTGEKPYKCEECGKAFKWSSKLTEHKVIHTGEKPCKCEE
CDKAFKHFSALRKHKVIHTGKKPYQCDECGKAFNNSSTLTKHKIIHTGEKPYKCEECGKA
FSQSSILTKHKIIHSVEKPYKCEECGKAFNQSSHLTRHKTIHTGEKPYKCEECGKAFIQC
SYLIRHKTIHTREKPTNVKKVPKLLSNPHTLLDKTIHTGEKPYKCEECAKAF
Download sequence
Identical sequences A6NN14
gi|336455120|ref|NP_001229609.1| NP_001229609.1.87134 NP_001229609.1.92137 ENSP00000469582 ENSP00000469582 ENSP00000470161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]