SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341913652|ref|XP_001716895.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341913652|ref|XP_001716895.3|
Domain Number 1 Region: 134-298
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-32
Family MAM domain 0.00084
Further Details:      
 
Domain Number 2 Region: 310-347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 428-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family EGF-type module 0.036
Further Details:      
 
Domain Number 4 Region: 350-389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 5 Region: 92-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 6 Region: 393-430
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000903
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|341913652|ref|XP_001716895.3|
Sequence length 564
Comment PREDICTED: MAM and LDL-receptor class A domain-containing protein C10orf112 [Homo sapiens]
Sequence
MISLGPHLYNDGKRGRRRRRAPNPVLSGSPTIPRQGSQQLGGWRGGSARHRARAFPEPEC
PRGRSALLKGPPQEEPNRRSALLSVGEISELCPEITDFLCRDKKCIASHLLCDYKPDCSG
RSDEAHCAHYTSTTGSCNFETSSGNWTTACSLTQDSEDDLDWAIGSRIPAKALIPDSDHT
PGSGQHFLYVNSSGSKEGSVARITTSKSFPASLGMCTVRFWFYMIDPRSMGILKVYTIEE
SGLNILVWSVIGNKRTGWTYGSVPLSSNSPFKVAFEADLDGNEDIFIALDDISFTPECVT
GGPVPVQPSPCEADQFSCIYTLQCVPLSGKCDGHEDCIDGSDEMDCPLNPTPPLCSNMEF
PCSTDECIPSLLLCDGVPDCHFNEDELICSNKSCSNGALVCASSNSCIPAHQRCDGFADC
MDFQLDESSCSECPLNYCRNGGTCVVEKNGPMCRCRQGWKGNRCHIKFNPPATDFTYAQN
NTWTLLGIGLAFLMTHITVAVLCFLANRKVPIRKTEGSGNCAFVNPVYGNWSNPEKTESS
VYSFSNPLYGTTSGSLETLSHHLK
Download sequence
Identical sequences gi|341913652|ref|XP_001716895.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]