SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341913656|ref|XP_003403668.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341913656|ref|XP_003403668.1|
Domain Number 1 Region: 741-902
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-45
Family MAM domain 0.0008
Further Details:      
 
Domain Number 2 Region: 532-694
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-31
Family MAM domain 0.005
Further Details:      
 
Domain Number 3 Region: 353-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-24
Family MAM domain 0.0079
Further Details:      
 
Domain Number 4 Region: 83-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000174
Family MAM domain 0.031
Further Details:      
 
Domain Number 5 Region: 923-964
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 311-349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 704-738
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|341913656|ref|XP_003403668.1|
Domain Number - Region: 235-304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000807
Family MAM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|341913656|ref|XP_003403668.1|
Sequence length 1003
Comment PREDICTED: MAM and LDL-receptor class A domain-containing protein C10orf112-like [Homo sapiens]
Sequence
MPRTGAQDGAWIQKQVVFEGQMASTYEQDEVIAIDDISFSSGCLPANDGILLCQEALNAE
RELCHPDTDLCRFDATDEELRLCQACGFEFDMCEWTSEASAGQISWMRTKAREIPAFEST
PQQDQGGDDEGYYVWVGAKHGFTLNHLDSRAYLNSSVCHCLGKSCHLQFYYAMESSVLRV
RLYNNKMRSKVVKLNNIDFGTLDFFTGREKHRLASLRDRVLINMLNIFLESFFNFTTKTL
DFLVLYIIQEEEIFWTYNISTHSQWVKADVLIPEDLKTFKIIFEGTLLSRRSFIALDHLW
VYACGQTQSRKLCSADEFPCTSGQCIAKESVCDSRQDCSDESDEDPATCSKHLTCDFESG
FCGWEPFLTEDSHWKLMKGLNNGEHHFPAADHTANINHGSFIYLEAQRSPGVAKLGSPVL
TKLLTASTPCQVQFWYHLSQHSNLSVFTRTSLDGNLQKQGKIIRFSESQWSHAKIDLIAE
AGESTLPFQLILEATVLSSNATVALDDISVSQECEISYKSLPRTSTQSKFSKCDFEANSC
DWFEAISGDHFDWIRSSQSELSADFEHQAPPRDHSLNASQGHFMFILKKSSSLWQVAKLQ
SPTFSQTGPGCILSFWFYNYGLSVGAAELQLHMENSHDSTVIWRVLYNQGKQWLEATIQL
GRLSQPFHLSLDKVSLGIYDGVSAIDDIRFENCTLPLPAESCEGLDHFWCRHTRACIEKL
RLCDLVDDCGDRTDEVNCAPELQCNFETGICNWEQDAKDDFDWTRNQGPTPTLNTGPMKD
NTLGTAKGHYLYIESSEPQAFQDSAALLSPILNATDTKGCTFRFYYHMFGKRIYRLAIYQ
RIWSDSRGQLLWQIFGNQGNRWIRKHLNISSRQPFQILVEASVGDGFTGDIAIDDLSFMD
CTLYPGNLPADLPTPPETSVPVTLPPHNCTDNEFICRSDGHCIEKMQKCDFKYDCPDKSD
EASCALSTVKTSQPPDSVAAASKKTNGVSAALCGTSFCRWALY
Download sequence
Identical sequences gi|341913656|ref|XP_003403668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]