SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|341915839|ref|XP_001727013.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341915839|ref|XP_001727013.2|
Domain Number 1 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 349-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.71e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 572-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 9 Region: 628-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 672-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 181-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000265
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 733-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000885
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 13 Region: 143-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000121
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|341915839|ref|XP_001727013.2|
Sequence length 824
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 208 [Homo sapiens]
Sequence
MGSLTFRDVAIQFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAPKPDLIIFLEQGK
EPWNMKRHELVKEPPVICSHFAQDLWPEQGREDSFQKVILRRYEKCGHENLQLKIGCTNV
DECKVHKKGYNKLNQSLTTTQSKVFQCGKYANIFHKCSNSKRHKIRHTGKKLLKCKEYVR
SFCMLSHLSQHKRIYTRENSYKSEEHGKAFNWSSALTYKRIHTGEKPCKCEECGKAFSKF
SILTKHKVIHTGEKHYKCEECGKAFTRSSSLIEHKRSHAGEKPYKCEECGKAFSKASTLT
AHKTIHAGEKPYKCEECGKAFNRSSNLMEHKRIHTGEKPCKCEECGKAFGNFSTLTKHKV
IHTGEKPYKCEECGKAFSWPSSLTEHKRIHAGDKPYKCEECGKTFKWSSTLTKHKIIHTG
EKPYKCEECGKAFTTFSSLTKHKVIHTGEKHYKCEECGKVFSWSSSLTTHKAIHAGEKLY
KCEECGKAFKWSSNLMEHKRIHTGEKPYKCEECGKAFSKVANLTKHKVIHTGEKQYKCEE
CGKAFIWSSRLSEHKRIHTGEKPYKCEECGKAFSWVSVLNKHKKIHAGKKFYKCEECGKD
FNQSSHLTTHKRIHTEEKPYKCEKCGKAFNXFLTLTEHKGIYTGGKPYKCEECGKFFNCS
SILTKHKVIHTGGNSYNCVECGKAFNQSLRLTTYKTTHTGEKPYTCEECGKASNRSSILN
RHKLIHTREKLYKRNHTGEKSXKCEECDKAFKWLSHLIVGKISHTGENYXNKQCGKTFNQ
CSCLIAKESIYTSLGNRGRLSRGKNVNVINIFSHLIQHQRVHTK
Download sequence
Identical sequences gi|341915839|ref|XP_001727013.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]