SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38201612|ref|NP_937847.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38201612|ref|NP_937847.1|
Domain Number 1 Region: 74-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.62e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38201612|ref|NP_937847.1|
Sequence length 244
Comment max-like protein X isoform beta [Homo sapiens]
Sequence
MTEPGASPEDPWVKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDED
SDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKA
IVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVS
DQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLK
NQLY
Download sequence
Identical sequences K7DK97 Q5R6H5
ENSPPYP00000009428 ENSP00000416627 ENSPPYP00000009428 ENSP00000416627 gi|38201612|ref|NP_937847.1| NP_001127572.1.23681 NP_937847.1.87134 NP_937847.1.92137 XP_003813942.1.60992 XP_511513.2.37143 GO.40222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]