SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38570117|ref|NP_689697.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38570117|ref|NP_689697.2|
Domain Number 1 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-27
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-26
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 4 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.68e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.15e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 222-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 632-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 9 Region: 185-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 325-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000031
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 493-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000413
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 409-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000248
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38570117|ref|NP_689697.2|
Sequence length 686
Comment zinc finger protein 569 [Homo sapiens]
Sequence
MTESQGTVTFKDVAIDFTQEEWKRLDPAQRKLYRNVMLENYNNLITVGYPFTKPDVIFKL
EQEEEPWVMEEEVLRRHWQGEIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFA
NVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVKCLMRKEHCEYNEPVKSYGNSSSH
FVITPFKCNHCGKGFNQTLDLIRHLRIHTGEKPYECSNCRKAFSHKEKLIKHYKIHSREQ
SYKCNECGKAFIKMSNLIRHQRIHTGEKPYACKECEKSFSQKSNLIDHEKIHTGEKPYEC
NECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCG
KAFSQFSMLIIHVRIHTGEKPYECNECGKAFSQSSALTVHMRSHTGEKPYECKECRKAFS
HKKNFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSN
LIAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNECGKAFSQIASLTLH
LRSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGH
TGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEK
PYHCIECGKAFSQKSHLVRHQRIHTH
Download sequence
Identical sequences A0A024R0G4 H2RBK9 Q5MCW4
ENSP00000325018 9598.ENSPTRP00000018688 9606.ENSP00000325018 ENSPTRP00000055859 ENSP00000325018 ENSP00000375992 NP_689697.2.87134 NP_689697.2.92137 XP_001165314.1.37143 XP_001165420.2.37143 XP_001165483.1.37143 XP_009433755.1.37143 XP_011524841.1.92137 XP_016791300.1.37143 XP_016881865.1.92137 XP_016881866.1.92137 XP_524240.2.37143 ENSP00000325018 ENSP00000375992 gi|38570117|ref|NP_689697.2| ENSPTRP00000055859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]