SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|40548328|ref|NP_954984.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|40548328|ref|NP_954984.1|
Domain Number - Region: 179-213
Classification Level Classification E-value
Superfamily UBA-like 0.00548
Family UBA domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|40548328|ref|NP_954984.1|
Sequence length 215
Comment nascent polypeptide-associated complex subunit alpha-2 [Homo sapiens]
Sequence
MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEID
EEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAY
IVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKD
VKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Download sequence
Identical sequences Q9H009
ENSP00000427802 ENSP00000427802 gi|40548328|ref|NP_954984.1| NP_954984.1.87134 NP_954984.1.92137 ENSP00000427802 GO.46346 HR4845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]