SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|42716289|ref|NP_976218.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42716289|ref|NP_976218.1|
Domain Number 1 Region: 360-503
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 256-361
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-36
Family Second domain of FERM 0.000000825
Further Details:      
 
Domain Number 3 Region: 210-255
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000393
Family First domain of FERM 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|42716289|ref|NP_976218.1|
Sequence length 775
Comment protein 4.1 isoform 2 [Homo sapiens]
Sequence
MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDT
PTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGT
SLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECS
KIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECVVETWLDSAKEIKKQV
RGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQS
ELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSM
YGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGE
QEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQA
QTRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAITQGQVAEGGVL
DASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKDLDKSQEEIKKHHASISELK
KNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSE
IPTKDVPIVHTETKTITYEAAQTDDNSGDLDPGVLLTAQTITSETPSSTTTTQITKTVKG
GISETRIEKRIVITGDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEIADE
Download sequence
Identical sequences 9606.ENSP00000290100 ENSP00000290100 gi|42716289|ref|NP_976218.1| NP_976218.1.87134 NP_976218.1.92137 XP_016856078.1.92137 ENSP00000290100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]