SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4502139|ref|NP_001156.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4502139|ref|NP_001156.1|
Domain Number 1 Region: 249-336,542-579
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 5.23e-45
Family Inhibitor of apoptosis (IAP) repeat 0.00000548
Further Details:      
 
Domain Number 2 Region: 161-252
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.22e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000863
Further Details:      
 
Domain Number 3 Region: 21-112
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.31e-30
Family Inhibitor of apoptosis (IAP) repeat 0.0003
Further Details:      
 
Domain Number 4 Region: 441-537
Classification Level Classification E-value
Superfamily DEATH domain 1.13e-21
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4502139|ref|NP_001156.1|
Sequence length 604
Comment baculoviral IAP repeat-containing protein 3 [Homo sapiens]
Sequence
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
Download sequence
Identical sequences Q13489
gi|33946285|ref|NP_892007.1| gi|4502139|ref|NP_001156.1| ENSP00000263464 ENSP00000432907 ENSP00000481903 NP_001156.1.87134 NP_001156.1.92137 NP_892007.1.87134 NP_892007.1.92137 XP_016873132.1.92137 9606.ENSP00000263464 ENSP00000263464 ENSP00000432907 HR3628 ENSP00000263464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]