SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4504655|ref|NP_003846.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4504655|ref|NP_003846.1|
Domain Number 1 Region: 365-522
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-30
Family Toll/Interleukin receptor TIR domain 0.00032
Further Details:      
 
Domain Number 2 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000329
Family I set domains 0.074
Further Details:      
 
Domain Number 3 Region: 25-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000315
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  gi|4504655|ref|NP_003846.1|
Domain Number - Region: 128-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000612
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4504655|ref|NP_003846.1|
Sequence length 541
Comment interleukin-18 receptor 1 precursor [Homo sapiens]
Sequence
MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
S
Download sequence
Identical sequences Q13478
9606.ENSP00000233957 ENSP00000233957 ENSP00000386663 ENSP00000387211 NP_003846.1.87134 NP_003846.1.92137 gi|4504655|ref|NP_003846.1| ENSP00000233957 ENSP00000233957 ENSP00000386663 ENSP00000387211 NYSGRC-IgSF-IL18R_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]