SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4506271|ref|NP_000307.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506271|ref|NP_000307.1|
Domain Number 1 Region: 103-195
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.14e-25
Family Hormone receptor domain 0.00083
Further Details:      
 
Domain Number 2 Region: 150-480
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000174
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4506271|ref|NP_000307.1|
Sequence length 593
Comment parathyroid hormone/parathyroid hormone-related peptide receptor precursor [Homo sapiens]
Sequence
MGTARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPA
SIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETRE
REVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVK
DAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK
WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVH
YIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKP
GTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQEEWETVM
Download sequence
Identical sequences A0A024R2Z8 Q03431
gi|296080761|ref|NP_001171673.1| gi|4506271|ref|NP_000307.1| ENSP00000321999 ENSP00000402723 ENSP00000411424 ENSP00000413774 9606.ENSP00000321999 ENSP00000321999 ENSP00000402723 ENSP00000411424 ENSP00000413774 ENSP00000321999 NP_000307.1.87134 NP_000307.1.92137 NP_001171673.1.87134 NP_001171673.1.92137 XP_016862422.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]