SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4506923|ref|NP_002342.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506923|ref|NP_002342.1|
Domain Number 1 Region: 7-102
Classification Level Classification E-value
Superfamily SH2 domain 3.14e-29
Family SH2 domain 0.0000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4506923|ref|NP_002342.1|
Sequence length 128
Comment SH2 domain-containing protein 1A isoform 1 [Homo sapiens]
Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTE
TGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIRED
PDVCLKAP
Download sequence
Identical sequences A0A096NCY9 A0A0D9S0F2 A0A2I3HCE7 A0A2K5KRT7 A0A2K6CKW8 A0A2K6JR17 A0A2K6Q3D7 F7INK7 G3SKS3 G7NRC6 G8F322 H2PWP7 H2R4K1 O60880 Q71S10
ENSCJAP00000038262 ENSPPYP00000023169 ENSNLEP00000018380 ENSP00000360181 ENSPTRP00000047271 gi|4506923|ref|NP_002342.1| 1ka6A ENSP00000360181 ENSGGOP00000028716 ENSPPYP00000023169 ENSP00000353126 ENSGGOP00000028716 ENSCJAP00000038257 NP_001028009.1.72884 NP_002342.1.87134 NP_002342.1.92137 XP_002763282.1.60252 XP_002832124.2.23681 XP_004064880.2.27298 XP_005594577.1.63531 XP_008017693.1.81039 XP_008974970.1.60992 XP_009437879.2.37143 XP_010383478.1.97406 XP_011716907.1.29376 XP_011856900.1.47321 XP_011856901.1.47321 XP_011916520.1.92194 XP_011916521.1.92194 XP_012354485.1.23891 XP_017704237.1.44346 ENSMMUP00000009961 1ka6_A 1ka7_A ENSNLEP00000018380 ENSMMUP00000009958 9544.ENSMMUP00000009961 9598.ENSPTRP00000047272 9600.ENSPPYP00000023169 9606.ENSP00000360181 ENSPTRP00000047271 ENSPANP00000010711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]