SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46094058|ref|NP_005434.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46094058|ref|NP_005434.4|
Domain Number 1 Region: 395-618
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.19e-75
Family ATP sulfurylase catalytic domain 0.00000000119
Further Details:      
 
Domain Number 2 Region: 225-392
Classification Level Classification E-value
Superfamily PUA domain-like 1.39e-52
Family ATP sulfurylase N-terminal domain 0.0000000237
Further Details:      
 
Domain Number 3 Region: 34-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.06e-41
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46094058|ref|NP_005434.4|
Sequence length 624
Comment bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 [Homo sapiens]
Sequence
MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGL
SGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLF
ADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAG
EIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVP
ENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGG
VINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTC
KNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL
RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGV
LNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPS
HGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQK
PPEGFMAPKAWTVLTEYYKSLEKA
Download sequence
Identical sequences A0A2I3HQ83 K7CTZ2 O43252
NP_005434.4.87134 NP_005434.4.92137 XP_003257787.1.23891 ENSP00000265174 ENSP00000265174 ENSNLEP00000015796 gi|46094058|ref|NP_005434.4| ENSNLEP00000015796 ENSP00000265174 9606.ENSP00000265174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]