SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|48717241|ref|NP_001001661.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48717241|ref|NP_001001661.1|
Domain Number 1 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 646-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 590-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 6-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-18
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 688-740
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 339-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.37e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 451-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000244
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 244-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000365
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 553-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000468
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 183-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000307
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|48717241|ref|NP_001001661.1|
Sequence length 752
Comment zinc finger protein 425 [Homo sapiens]
Sequence
MAEPASVTVTFDDVALYFSEQEWEILEKWQKQMYKQEMKTNYETLDSLGYAFSKPDLITW
MEQGRMLLISEQGCLDKTRRTTSPPTDEQLNMKNTGKLLCFDDEGTPRTKEEDCRLNGPQ
KQDLCAALRGKERKILLAQTATFQSPSLRETEILNKKVSITAYDPDKKDLRHKPRETPGR
LEIPTGPRCYSCYVCRKVFQVRRDLLKHKRSHSKSQLCRYPKYKNSSRGKSELRRTQRLL
CQKKRFQCSECEKSYFLKGSLVTHQVVHTGQRPYPCPECDKTFRYRANLKKHLCLHRGER
PFCCGECGRAFVQQCELTEHLRLHSGEKPFQCPQCDRCFRLKRGMKVHLTQHSGKRPFHC
PECGRSFSRKAALKTHQRTHSEEKPFSCGECGRKFIYKIKLDEHIRVHTGEKPFSCPECN
KSFRLKRSLKAHGLQHIGKRPFQCPECSRGFFWRNAMRAHQRLHSEQKPFPCAECGKRFT
RPSKLACHTRVHDRQKEFPCGECKKTFSQQSRLTQHLKVHTTEKPFSCAECGRSFRRRAH
LTEHTRLHSGEEPFQCPECDKSFSWKASMKFHQRMHRDEKPFACGECDKTYTHQSQLTEH
LRLHSGEKPYQCPECEKTFRLKGNLKSHLLQHSGQKPFSCVMCGKSFTQQYRLTEHIRVH
SGEKPFQCPECDKSYCIRGSLKVHLYKHSGERPFQCPECGKGFLQKRSLKAHLCLHSGER
PFSCDECGRSFTYVGALKTHIAVHAKEKPSSL
Download sequence
Identical sequences A0A090N7U3 Q6IV72
9606.ENSP00000367300 ENSP00000367300 gi|48717241|ref|NP_001001661.1| NP_001001661.1.87134 NP_001001661.1.92137 ENSP00000367300 ENSP00000367300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]