SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|48762709|ref|NP_071419.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48762709|ref|NP_071419.3|
Domain Number 1 Region: 237-303
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.65e-18
Family SAM (sterile alpha motif) domain 0.0000992
Further Details:      
 
Domain Number 2 Region: 158-226
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000801
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|48762709|ref|NP_071419.3|
Sequence length 373
Comment SAM domain-containing protein SAMSN-1 [Homo sapiens]
Sequence
MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTS
NNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSL
KASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYD
TDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNS
KKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAE
NFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLS
DMVHKIIITEPSD
Download sequence
Identical sequences Q9NSI8
ENSP00000383411 gi|48762709|ref|NP_071419.3| NP_071419.3.87134 NP_071419.3.92137 9606.ENSP00000383411 ENSP00000383411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]