SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|49574543|ref|NP_848618.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49574543|ref|NP_848618.2|
Domain Number 1 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 501-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 613-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 446-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 669-726
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 557-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 9 Region: 3-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 10 Region: 221-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 11 Region: 179-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 12 Region: 711-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Weak hits

Sequence:  gi|49574543|ref|NP_848618.2|
Domain Number - Region: 146-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000125
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|49574543|ref|NP_848618.2|
Sequence length 781
Comment zinc finger protein 616 [Homo sapiens]
Sequence
MATQGHLTFKDVAIEFSQEEWKCLEPVQKALYKDVMLENYRNLVFLGISPKCVIKELPPT
ENSNTGERFQTVALERHQSYDIENLYFREIQKHLHDLEFQWKDGETNDKEVPVPHENNLT
GKRDQHSQGDVENNHIENQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHI
REKTYVCNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVVHTRGKS
YQCDVCGKIFRKNSYFVRHQRSHTGQKPYICNECGKSFSKSSHLAVHQRIHTGEKPYKCN
LCGKSFSQRVHLRLHQTVHTGERPFKCNECGKTFKRSSNLTVHQVIHAGKKPYKCDVCGK
AFRHRSNLVCHRRIHSGEKQYKCNECGKVFSKRSSLAVHRRIHTVEKPCKCNECGKVFSK
RSSLAVHQRIHTGQKTYKCNKCGKVYSKHSHLAVHWRIHTGEKAYKCNECGKVFSIHSRL
AAHQRIHTGEKPYKCNECGKVFSQHSRLAVHRRIHTGEKPYKCKECGKVFSDRSAFARHR
RIHTGEKPYKCKECGKVFSQCSRLTVHRRIHSGEKPYKCNECGKVYSQYSHLVGHRRVHT
GEKPYKCHECGKAFNQGSTLNRHQRIHTGEKPYKCNQCGNSFSQRVHLRLHQTVHTGDRP
YKCNECGKTFKRSSNLTAHQIIHAGKKPYKCDECGKVFRHSSHLVSHQRIHTGEKRYKCI
ECGKAFGRLFSLSKHQRIHSGKKPYKCNECGKSFICRSGLTKHRIRHTGESLTTKLNVTR
P
Download sequence
Identical sequences Q08AN1
ENSP00000471000 9606.ENSP00000328722 gi|49574543|ref|NP_848618.2| ENSP00000471000 ENSP00000328722 NP_848618.2.87134 NP_848618.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]