SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52138523|ref|NP_597717.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52138523|ref|NP_597717.1|
Domain Number 1 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.96e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 351-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 617-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 575-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 1-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-19
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 10 Region: 78-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000138
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 202-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000854
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|52138523|ref|NP_597717.1|
Sequence length 676
Comment zinc finger protein 418 [Homo sapiens]
Sequence
MQGTVAFEDVAVNFSQEEWSLLSEVQRCLYHDVMLENWVLISSLGCWCGSEDEEAPSKKS
ISIQRVSQVSTPGAGVSPKKAHSCEMCGAILGDILHLADHQGTHHKQKLHRCEAWGNKLY
DSSNRPHQNQYLGEKPYRSSVEEALFVKRCKFHVSEESSIFIQSGKDFLPSSGLLLQEAT
HTGEKSNSKPECESPFQWGDTHYSCGECMKHSSTKHVFVQQQRLPSREECYCWECGKSFS
KYDSVSNHQRVHTGKRPYECGECGKSFSHKGSLVQHQRVHTGKRPYECGECGKSFSHKGS
LVQHQRVHTGERPYECGECGKSFSQNGTLIKHQRVHTGERPYECEECGKCFTQKGNLIQH
QRGHTSERPYECEECGKCFSQKGTLTEHHRVHTRERPYECGECGKSFSRKGHLRNHQRGH
TGERPYECGECGKSFSRKGNLIQHQRSHTGERPYECRECRKLFRGKSHLIEHQRVHTGER
PYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSFPQSCSLLRHRRVHTGERPYEC
GECGKSFHQSSSLLRHQKTHTAERPYECRECGKFFSSLLEHRRVHTGERPYECRECGKTF
TRRSAHFKHQRLHTRGKPYECSECGKSFAETFSLTEHRRVHTGERPYECSECGKSFHRSS
SLLRHQRVHTERSPYK
Download sequence
Identical sequences Q8TF45
9606.ENSP00000379451 gi|52138523|ref|NP_597717.1| ENSP00000379451 ENSP00000471652 ENSP00000379451 ENSP00000471652 ENSP00000483763 NP_001303958.1.87134 NP_001303958.1.92137 NP_597717.1.87134 NP_597717.1.92137 XP_016881801.1.92137 XP_016881802.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]