SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5454086|ref|NP_006298.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5454086|ref|NP_006298.1|
Domain Number 1 Region: 261-319
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 114-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 77-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000667
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|5454086|ref|NP_006298.1|
Sequence length 464
Comment sushi repeat-containing protein SRPX isoform 1 [Homo sapiens]
Sequence
MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPI
KVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRC
PTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPP
RIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYT
VYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSP
ARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLG
MLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVD
KHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT
Download sequence
Identical sequences G3RY54 K7B5Z1 P78539
ENSGGOP00000020741 hsi002013589.1 hsi002013589.2 NP_006298.1.87134 NP_006298.1.92137 XP_004064042.1.27298 XP_016799387.1.37143 ENSP00000367794 ENSP00000367794 gi|5454086|ref|NP_006298.1| ENSP00000339211 9606.ENSP00000367794 ENSGGOP00000020741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]