SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|54792148|ref|NP_056243.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54792148|ref|NP_056243.1|
Domain Number 1 Region: 766-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 710-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 640-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.32e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 812-864
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-16
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 7 Region: 560-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000458
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 481-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000671
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 204-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000491
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 314-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000863
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 246-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000197
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000379
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54792148|ref|NP_056243.1|
Sequence length 871
Comment zinc finger protein 473 [Homo sapiens]
Sequence
MAEEFVTLKDVGMDFTLGDWEQLGLEQGDTFWDTALDNCQDLFLLDPPRPNLTSHPDGSE
DLEPLAGGSPEATSPDVTETKNSPLMEDFFEEGFSQEIIEMLSKDGFWNSNFGEACIEDT
WLDSLLGDPESLLRSDIATNGESPTECKSHELKRGLSPVSTVSTGEDSMVHNVSEKTLTP
AKSKEYRGEFFSYSDHSQQDSVQEGEKPYQCSECGKSFSGSYRLTQHWITHTREKPTVHQ
ECEQGFDRNASLSVYPKTHTGYKFYVCNEYGTTFSQSTYLWHQKTHTGEKPCKSQDSDHP
PSHDTQPGEHQKTHTDSKSYNCNECGKAFTRIFHLTRHQKIHTRKRYECSKCQATFNLRK
HLIQHQKTHAAKTTSECQECGKIFRHSSLLIEHQALHAGEEPYKCNERGKSFRHNSTLKI
HQRVHSGEKPYKCSECGKAFHRHTHLNEHRRIHTGYRPHKCQECVRSFSRPSHLMRHQAI
HTAEKPYSCAECKETFSDNNRLVQHQKMHTVKTPYECQECGERFICGSTLKCHESVHARE
KQGFFVSGKILDQNPEQKEKCFKCNKCEKTFSCSKYLTQHERIHTRGVKPFECDQCGKAF
GQSTRLIHHQRIHSRVRLYKWGEQGKAISSASLIKLQSFHTKEHPFKCNECGKTFSHSAH
LSKHQLIHAGENPFKCSKCDRVFTQRNYLVQHERTHARKKPLVCNECGKTFRQSSCLSKH
QRIHSGEKPYVCDYCGKAFGLSAELVRHQRIHTGEKPYVCQECGKAFTQSSCLSIHRRVH
TGEKPYRCGECGKAFAQKANLTQHQRIHTGEKPYSCNVCGKAFVLSAHLNQHLRVHTQET
LYQCQRCQKAFRCHSSLSRHQRVHNKQQYCL
Download sequence
Identical sequences A0A024QZI1 Q8WTR7
gi|54792148|ref|NP_056243.1| gi|54792150|ref|NP_001006657.1| NP_001006657.1.87134 NP_001006657.1.92137 NP_056243.1.87134 NP_056243.1.92137 ENSP00000270617 ENSP00000375697 ENSP00000472808 9606.ENSP00000270617 hso003003493.14 hso003003493.15 hso003003493.16 hso003003493.18 ENSP00000270617 ENSP00000270617 ENSP00000375697 ENSP00000472808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]