SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55743094|ref|NP_004307.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55743094|ref|NP_004307.2|
Domain Number 1 Region: 122-196
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55743094|ref|NP_004307.2|
Sequence length 236
Comment achaete-scute homolog 1 [Homo sapiens]
Sequence
MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ
QQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAV
ARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAV
SAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Download sequence
Identical sequences P50553
ENSP00000266744 ENSP00000266744 9606.ENSP00000266744 NP_004307.2.87134 NP_004307.2.92137 gi|55743094|ref|NP_004307.2| HR4461 ENSP00000266744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]