SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55769537|ref|NP_149350.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55769537|ref|NP_149350.3|
Domain Number 1 Region: 778-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 947-1003
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 834-891
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 722-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 988-1040
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 890-947
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 500-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 12 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000164
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 13 Region: 436-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000666
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 14 Region: 334-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000217
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 15 Region: 296-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000026
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55769537|ref|NP_149350.3|
Sequence length 1059
Comment zinc finger protein 658 [Homo sapiens]
Sequence
MNMSQASVSFQDVTVEFTREEWQHLGPVERTLYRDVMLENYSHLISVGYCITKPKVISKL
EKGEEPWSLEDEFLNQRYPGYFKVDHIKGIREKQEKPLWQEIFISDADKTLSKEGQKVLE
KPFNLEIAPELSEKISCKCDSHRMNLPVASQLIISERKYSRKKTEYMNVCEKLQLDIKHE
KAHAEEKSYEHGENAKAFSYKKDQHWKFQTLEESFECDGSGQGLYDKTICITPQSFLTGE
KSCKDDEFRKNFDKITLFNHMRTDTRGKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECN
ERGINFSRKSPLTQSQRTITGWSAFESNKCEENFSQSSAHIVHQKTQAGDKFGEHNECTD
ALYQKLDFTAHQRIHTEDKFYLSDEHGKCRKSFYRKAHLIQHQRPHSGEKTYQYEECAKS
FCSSSHPIQHPGTYVGFKLYECNECGKAFCQNSNLSKHLRIHTKEKPCDNNGCGRSYKSP
LIGHQKTDAEMELCGGSEYGKTSHLKGHQRILMGEKPYECIECGKTFSKTSHLRAHQRIH
TGEKPYECVECEKTFSHKTHLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRIHTGEK
PYECSDCEKTFAHNSALRAHHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTGEKPYEC
NECGRSFTYNSALRAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYECNECE
KTFAHNSALRAHQNIHTGEKLYECSECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFS
QKSYLSGHERIHTGEKPYECNVCGKTFVYKAALIVHQRIHTGEKPYECNQCGKTFSQRTH
LCAHQRIHTGEKPYECNECGKTFADNSALRAHHRIHTGEKPYECNDCGKTFSKTSHLRAH
LRTRSGEKPYECSECGKTFSEKSYVSAHQRVHTGEKPYECNVCGKPFAHNSTLRVHQRIH
TGEKSYECNDCGKTFSQKSHLSAHQRIHTGEKPYECNECGKAFAQNSTLRVHQRIHTGEK
PYECDECGKTFVRKAALRVHHTRMHTREKTLACNGFGKS
Download sequence
Identical sequences Q5TYW1
ENSP00000366853 ENSP00000473484 9606.ENSP00000366853 ENSP00000482447 ENSP00000482540 NP_001304845.1.87134 NP_001304845.1.92137 NP_149350.3.87134 NP_149350.3.92137 XP_005272572.1.92137 XP_011543981.1.92137 XP_016870103.1.92137 ENSP00000366853 gi|55769537|ref|NP_149350.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]