SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|61742136|ref|NP_078831.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|61742136|ref|NP_078831.3|
Domain Number 1 Region: 187-523
Classification Level Classification E-value
Superfamily RNI-like 3.4e-25
Family Rna1p (RanGAP1), N-terminal domain 0.077
Further Details:      
 
Domain Number 2 Region: 104-163
Classification Level Classification E-value
Superfamily F-box domain 0.00000000222
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|61742136|ref|NP_078831.3|
Sequence length 533
Comment F-box/LRR-repeat protein 6 isoform 2 [Homo sapiens]
Sequence
MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQ
RRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEIL
VQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKK
LLASLEWLMPNRFSQLQRLTLIHWKSQLVGECCPRLTFLKLSGCHGVTADALVMLAKACC
QLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSCCPQLQVLEVS
TGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEELCLASS
TCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGTSDRLTL
AKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNLRGTRVT
PSTVSSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS
Download sequence
Identical sequences gi|61742136|ref|NP_078831.3| ENSP00000403873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]