SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68303809|ref|NP_003414.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68303809|ref|NP_003414.2|
Domain Number 1 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 686-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.95e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 7 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 9 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 10 Region: 733-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 11 Region: 256-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-16
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 13 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000313
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|68303809|ref|NP_003414.2|
Sequence length 809
Comment zinc finger protein 43 [Homo sapiens]
Sequence
MGPLTFMDVAIEFCLEEWQCLDIAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQEK
EPWEPMRRHEMVAKPPVMCSHFTQDFWPEQHIKDPFQKATLRRYKNCEHKNVHLKKDHKS
VDECKVHRGGYNGFNQCLPATQSKIFLFDKCVKAFHKFSNSNRHKISHTEKKLFKCKECG
KSFCMLPHLAQHKIIHTRVNFCKCEKCGKAFNCPSIITKHKRINTGEKPYTCEECGKVFN
WSSRLTTHKKNYTRYKLYKCEECGKAFNKSSILTTHKIIRTGEKFYKCKECAKAFNQSSN
LTEHKKIHPGEKPYKCEECGKAFNWPSTLTKHKRIHTGEKPYTCEECGKAFNQFSNLTTH
KRIHTAEKFYKCTECGEAFSRSSNLTKHKKIHTEKKPYKCEECGKAFKWSSKLTEHKLTH
TGEKPYKCEECGKAFNWPSTLTKHNRIHTGEKPYKCEVCGKAFNQFSNLTTHKRIHTAEK
PYKCEECGKAFSRSSNLTKHKKIHIEKKPYKCEECGKAFKWSSKLTEHKITHTGEKPYKC
EECGKAFNHFSILTKHKRIHTGEKPYKCEECGKAFTQSSNLTTHKKIHTGEKFYKCEECG
KAFTQSSNLTTHKKIHTGGKPYKCEECGKAFNQFSTLTKHKIIHTEEKPYKCEECGKAFK
WSSTLTKHKIIHTGEKPYKCEECGKAFKLSSTLSTHKIIHTGEKPYKCEKCGKAFNRSSN
LIEHKKIHTGEQPYKCEECGKAFNYSSHLNTHKRIHTKEQPYKCKECGKAFNQYSNLTTH
NKIHTGEKLYKPEDVTVILTTPQTFSNIK
Download sequence
Identical sequences P17038
9606.ENSP00000347045 ENSP00000347045 ENSP00000465732 NP_003414.2.87134 NP_003414.2.92137 gi|68303809|ref|NP_003414.2| ENSP00000347045 ENSP00000465732 ENSP00000347045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]