SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73486658|ref|NP_002071.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73486658|ref|NP_002071.2|
Domain Number 1 Region: 31-429
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.27e-126
Family AAT-like 0.00000000000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73486658|ref|NP_002071.2|
Sequence length 430
Comment aspartate aminotransferase, mitochondrial precursor [Homo sapiens]
Sequence
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEV
LKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADE
AKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVS
NLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGY
LAHAIHQVTK
Download sequence
Identical sequences P00505
9606.ENSP00000245206 NP_002071.2.87134 NP_002071.2.92137 gi|73486658|ref|NP_002071.2| ENSP00000245206 ENSP00000245206 ENSP00000245206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]