SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|7657118|ref|NP_055106.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7657118|ref|NP_055106.1|
Domain Number 1 Region: 33-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.22e-109
Family GABA-aminotransferase-like 0.00000000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|7657118|ref|NP_055106.1|
Sequence length 419
Comment 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial isoform 2 precursor [Homo sapiens]
Sequence
MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRV
DGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQSIHKNLEAKIA
RFHQREDAILYPSCYDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLD
MADLEAKLQEAQKHRLRLVATDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLG
PTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPP
AVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGASHPICPVMLGDARLAS
RMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGALP
Download sequence
Identical sequences O75600
NP_055106.1.87134 NP_055106.1.92137 XP_016884166.1.92137 gi|7657118|ref|NP_055106.1| ENSP00000248924 9606.ENSP00000248924 HR6698 ENSP00000248924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]